Product Description
Size: 20ul / 100ul
The TLE1 (87332-1-RR) by Proteintech is a Recombinant antibody targeting TLE1 in WB, ELISA applications with reactivity to human, mouse samples
87332-1-RR targets TLE1 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HEK-293 cells, Jurkat cells, mouse lung tissue, A549 cells, HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Background Information
TLE1 (Transducin-like enhancer protein 1) is a transcriptional corepressor and binds to a number of transcription factors. It can inhibit NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (PMID: 10660609). TLE1 is highly expressed in postnatal brain (PMID: 29758293; 27852056).
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag17299 Product name: Recombinant human TLE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-377 aa of BC010100 Sequence: KDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMVPH Predict reactive species
Full Name: transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)
Calculated Molecular Weight: 770 aa, 83 kDa
Observed Molecular Weight: 80-95 kDa
GenBank Accession Number: BC010100
Gene Symbol: TLE1
Gene ID (NCBI): 7088
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q04724
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924