{"product_id":"proteintech-87375-1-rr","title":"Proteintech, 87375-1-RR, MSMB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MSMB (87375-1-RR) by Proteintech is a Recombinant antibody targeting MSMB in WB, ELISA applications with reactivity to human samples\n87375-1-RR targets MSMB in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human urine sample\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMSMB  is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in the uterus, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag8674 Product name: Recombinant human MSMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC005257 Sequence: IPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII Predict reactive species\nFull Name: microseminoprotein, beta-\nCalculated Molecular Weight: 114 aa, 13 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC005257\nGene Symbol: MSMB\nGene ID (NCBI): 4477\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P08118\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888785969321,"sku":"87375-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87375-1-rr","provider":"Iright","version":"1.0","type":"link"}