Proteintech, 87390-1-RR, ZNHIT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZNHIT1 (87390-1-RR) by Proteintech is a Recombinant antibody targeting ZNHIT1 in WB, ELISA applications with reactivity to human, rat samples 87390-1-RR targets ZNHIT1 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HEK-293 cells, MOLT-4 cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ZNHIT1(Zinc finger HIT domain containing protein 1), aslo named CGBP1 (Cyclin G1 binding protein 1), is a subunit of the SNF-2 related CBP activator protein (SRCAP) complex, which can remodel chromatin by incorporating the histone variant H2A.Z into nucleosomes(PMID: 15647280). ZNHIT1 also can bind to myogenin promoter and mediate H2A.Z incorporation for its expression(PMID: 20473270). ZNHIT1 overexpression induces apoptosis and represses proliferation and invasion of breast cancer cells(PMID: 30928405). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9741 Product name: Recombinant human ZNHIT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC017333 Sequence: MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV Predict reactive species Full Name: zinc finger, HIT type 1 Calculated Molecular Weight: 154 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC017333 Gene Symbol: ZNHIT1 Gene ID (NCBI): 10467 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43257 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.