{"product_id":"proteintech-87480-4-rr","title":"Proteintech, 87480-4-RR, LY6K Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LY6K (87480-4-RR) by Proteintech is a Recombinant antibody targeting LY6K in WB, ELISA applications with reactivity to human samples\n87480-4-RR targets LY6K in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human testis tissue,  SiHa cells,  143B cells,  DU 145 cells,  A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe LY6K (Lymphocyte antigen 6K) protein belongs to the LY6\/uPAR superfamily and is a class of small glycoproteins that are anchored to the outer side of the cell membrane via glycosylphosphatidylinositol (GPI).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg5676 Product name: Recombinant human LY6K protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 18-138 aa of NM_017527.3 Sequence: DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG Predict reactive species\nFull Name: lymphocyte antigen 6 complex, locus K\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 18-26 kDa\nGenBank Accession Number: NM_017527.3\nGene Symbol: LY6K\nGene ID (NCBI): 54742\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q17RY6-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888778793129,"sku":"87480-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87480-4-rr","provider":"Iright","version":"1.0","type":"link"}