{"product_id":"proteintech-87486-1-rr","title":"Proteintech, 87486-1-RR, DDIT4L Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DDIT4L (87486-1-RR) by Proteintech is a Recombinant antibody targeting DDIT4L in WB, ELISA applications with reactivity to human, mouse samples\n87486-1-RR targets DDIT4L in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue, Y79 cells,  ARPE-19 cells,  mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNA-damage-inducible transcript 4-like protein(DDIT4L), encoded by the stress responsive gene REDD2, is a negative regulator of mTOR signaling, and expressed predominantly in skeletal muscle. It regulates the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1. Also,  DDIT4L involves in oxidized low-density lipoprotein-induced macrophage death sensitivity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29616 Product name: Recombinant human DDIT4L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC013592 Sequence: MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTE Predict reactive species\nFull Name: DNA-damage-inducible transcript 4-like\nCalculated Molecular Weight: 193 aa, 22 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC013592\nGene Symbol: DDIT4L\nGene ID (NCBI): 115265\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96D03\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888734228649,"sku":"87486-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87486-1-rr","provider":"Iright","version":"1.0","type":"link"}