Proteintech, 87496-1-RR, PPIL2 Recombinant monoclonal antibody

Size: 20ul / 100ul The PPIL2 (87496-1-RR) by Proteintech is a Recombinant antibody targeting PPIL2 in WB, ELISA applications with reactivity to human, mouse, rat samples 87496-1-RR targets PPIL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HEK-293 cells, rat kidney tissue, mouse thymus tissue, mouse pancreas tissue, rat testis tissue, human kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Peptidylprolyl isomerase (cyclophilin)-like 2 (PPIL2), also known as Cyclophilin-like protein Cyp-60, is a U-box-type E3 ubiquitin ligase belonging to the cyclophilin family. PPIL2 is also a target of the JAK2/STAT5 pathway and upregulated in patients with MPNs (PMID: 36092721, 25992900). PPIL2 is a large ~60 kDa (520 amino acids) protein that has a central cyclophilin-like domain and also has an N-terminal U-box domain that exhibits E3 ligase activity. Western detected PPIL2 at an apparent molecular mass of 60~70 kDa (PMID: 40338661, 29352246). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6018 Product name: Recombinant human PPIL2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 280-457 aa of NM_148176.2 Sequence: GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP Predict reactive species Full Name: peptidylprolyl isomerase (cyclophilin)-like 2 Calculated Molecular Weight: 59 kDa GenBank Accession Number: NM_148176.2 Gene Symbol: PPIL2 Gene ID (NCBI): 23759 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13356-2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.