Proteintech, 87516-1-RR, TUBG2 Recombinant monoclonal antibody

Size: 20ul / 100ul The TUBG2 (87516-1-RR) by Proteintech is a Recombinant antibody targeting TUBG2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, canine samples 87516-1-RR targets TUBG2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: HeLa cells, T-47D cells, SK-BR-3 cells, MDCK cells, COS-7 cells, mouse cerebellum tissue, rat cerebellum tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Specification Tested Reactivity: human, mouse, rat, canine Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27728 Product name: Recombinant human TUBG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 358-451 aa of BC051890 Sequence: VALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYISWGTQEQ Predict reactive species Full Name: tubulin, gamma 2 Calculated Molecular Weight: 451 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC051890 Gene Symbol: TUBG2 Gene ID (NCBI): 27175 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRH3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.