{"product_id":"proteintech-87529-1-rr","title":"Proteintech, 87529-1-RR, NOP10 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NOP10 (87529-1-RR) by Proteintech is a Recombinant antibody targeting NOP10 in WB, ELISA applications with reactivity to human, mouse, rat samples\n87529-1-RR targets NOP10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  Caco-2 cells,  COLO 320 cells,  mouse thymus tissue,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNucleolar protein 10 (NOP10)  is a component of the H\/ACA small nucleolar ribonucleoprotein (snoRNP) complex and is essential for maintaining telomerase activity and RNA pseudouridylation. NOP10 is abnormally expressed in a variety of cancers such as breast cancer, pancreatic cancer, lung cancer, etc., and high expression is usually associated with poor prognosis(PMID: 33161513; 39538226).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18718 Product name: Recombinant human NOP10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC063023 Sequence: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL Predict reactive species\nFull Name: NOP10 ribonucleoprotein homolog (yeast)\nCalculated Molecular Weight: 64 aa, 77 kDa\nObserved Molecular Weight: 10-12 kDa\nGenBank Accession Number: BC063023\nGene Symbol: NOP10\nGene ID (NCBI): 55505\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NPE3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888791376041,"sku":"87529-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87529-1-rr","provider":"Iright","version":"1.0","type":"link"}