{"product_id":"proteintech-87553-2-rr","title":"Proteintech, 87553-2-RR, BEX4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BEX4 (87553-2-RR) by Proteintech is a Recombinant antibody targeting BEX4 in WB, ELISA applications with reactivity to human samples\n87553-2-RR targets BEX4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, TT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBEX4, also known as BEXL1 and NADE3, which belongs to the BEX family. The brain-expressed X-linked (BEX) family consists of five member genes (from 1 to 5) that are commonly located on the X chromosome. The molecular weight of BEXs is approximately 15 kDa, but little is known about their structural characteristics and molecular functions (PMID: 34576008).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26207 Product name: Recombinant human BEX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC015794 Sequence: MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP Predict reactive species\nFull Name: brain expressed, X-linked 4\nCalculated Molecular Weight: 120 aa, 14 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC015794\nGene Symbol: BEX4\nGene ID (NCBI): 56271\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NWD9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888711487657,"sku":"87553-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87553-2-rr","provider":"Iright","version":"1.0","type":"link"}