Proteintech, 87663-1-RR, SSTR2 Recombinant monoclonal antibody

Size: 20ul / 100ul The SSTR2 (87663-1-RR) by Proteintech is a Recombinant antibody targeting SSTR2 in WB, ELISA applications with reactivity to human, mouse samples 87663-1-RR targets SSTR2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, Neuro-2a cells, C6 cells, mouse brian tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Somatostatin receptor 2 (SSTR2) is a G-protein coupled membrane receptor expressed in a variety of neural and neurosecretory tissue types. In neuroendocrine tumors (NETs), in which Somatostatin receptors (SSTRs) are commonly expressed, the detection of SSTR2 expression has both diagnostic and therapeutic potential. Besides NETs, SSTR2 immunostaining can be detected in other types of tumor cells(PMID:34786053). Moreover, SSTR2 is consistently expressed in Olfactory neuroblastoma (ONB) suggesting a role for somatostatin-analog based imaging and therapy in this disease. More generally, SSTR2 may be another marker of neuroendocrine diferentiation in ONB(PMID:33929681). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14205 Product name: Recombinant human SSTR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC019610 Sequence: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG Predict reactive species Full Name: somatostatin receptor 2 Calculated Molecular Weight: 369 aa, 41 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC019610 Gene Symbol: SSTR2 Gene ID (NCBI): 6752 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30874 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.