{"product_id":"proteintech-87663-1-rr","title":"Proteintech, 87663-1-RR, SSTR2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SSTR2 (87663-1-RR) by Proteintech is a Recombinant antibody targeting SSTR2 in WB, ELISA applications with reactivity to human, mouse samples\n87663-1-RR targets SSTR2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, Neuro-2a cells,  C6 cells,  mouse brian tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSomatostatin receptor 2 (SSTR2) is a G-protein coupled membrane receptor expressed in a variety of neural and neurosecretory tissue types. In neuroendocrine tumors (NETs), in which Somatostatin receptors (SSTRs) are commonly expressed, the detection of SSTR2 expression has both diagnostic and therapeutic potential. Besides NETs, SSTR2 immunostaining can be detected in other types of tumor cells(PMID:34786053). Moreover, SSTR2 is consistently expressed in Olfactory neuroblastoma (ONB) suggesting a role for somatostatin-analog based imaging and therapy in this disease. More generally, SSTR2 may be another marker of neuroendocrine diferentiation in ONB(PMID:33929681).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14205 Product name: Recombinant human SSTR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC019610 Sequence: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG Predict reactive species\nFull Name: somatostatin receptor 2\nCalculated Molecular Weight: 369 aa, 41 kDa\nObserved Molecular Weight: 85 kDa\nGenBank Accession Number: BC019610\nGene Symbol: SSTR2\nGene ID (NCBI): 6752\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P30874\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888827289769,"sku":"87663-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-87663-1-rr","provider":"Iright","version":"1.0","type":"link"}