{"product_id":"proteintech-98003-1-rr","title":"Proteintech, 98003-1-RR, Anti-Mouse IL-13 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-13 (98003-1-RR) by Proteintech is a Recombinant antibody targeting IL-13 in FC (Intra) applications with reactivity to mouse samples\n98003-1-RR targets IL-13 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: PMA and ionomycin stimulated C57BL\/6 Th2-polarized splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. IL-13 up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. IL-13 inhibits the production of a series of cytokines like IL-1, IL-6, TNF-alpha, and IL-8 by activated human monocytes. IL-13 induces IFN-gamma production by NK cells. IL-13 is thought to be an important cytokine in the pathogenesis of asthma, and more recently has been shown to play a pivotal role in a number of fibrotic diseases, including hepatic and pulmonary fibrosis, and nodular sclerosing Hodgkin's disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0266 Product name: Recombinant Mouse IL-13 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-131 aa of NM_008355 Sequence: SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF Predict reactive species\nFull Name: interleukin 13\nCalculated Molecular Weight: 14 kDa\nGenBank Accession Number: NM_008355\nGene Symbol: IL-13\nGene ID (NCBI): 16163\nRRID: AB_3672147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P20109\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888571797673,"sku":"98003-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98003-1-rr","provider":"Iright","version":"1.0","type":"link"}