{"product_id":"proteintech-98019-1-rr","title":"Proteintech, 98019-1-RR, Anti-Mouse IL-17F Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-17F (98019-1-RR) by Proteintech is a Recombinant antibody targeting IL-17F in FC (Intra) applications with reactivity to mouse samples\n98019-1-RR targets IL-17F in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe interleukin 17 (IL-17) family of cytokines contains 6 structurally related cytokines, IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 family plays crucial roles in host defense against microbial organisms and in the development of inflammatory diseases. IL-17A is a pro-inflammatory cytokine that also has the capacity to promote angiogenesis and osteoclastogenesis. IL-17F shares the highest homology with IL-17A and signals via a receptor composed by the IL-17RA and IL-17RC subunits. IL-17A and IL-17F can form IL-17A\/A or IL-17F\/F homodimers, IL-17A\/F heterodimers are also formed. IL-17A and IL-17F, produced by the Th17 CD4(+) T cell lineage, have been linked to a variety of inflammatory and autoimmune conditions. IL-17F levels are elevated in sera and lesional psoriatic skin compared to non-lesional tissue. IL-17F also has been implicated in the development of neutrophilic airway inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0671 Product name: Recombinant Mouse IL-17F protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-161 aa of NM_145856.2 Sequence: RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA Predict reactive species\nFull Name: interleukin 17F\nCalculated Molecular Weight: 17KD\nGenBank Accession Number: NM_145856.2\nGene Symbol: IL-17F\nGene ID (NCBI): 257630\nRRID: AB_3672163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q7TNI7-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888572846249,"sku":"98019-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98019-1-rr","provider":"Iright","version":"1.0","type":"link"}