{"product_id":"proteintech-98082-1-rr","title":"Proteintech, 98082-1-RR, Anti-Mouse IFN-beta Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IFN-beta (98082-1-RR) by Proteintech is a Recombinant antibody targeting IFN-beta in FC (Intra) applications with reactivity to mouse samples\n98082-1-RR targets IFN-beta in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterferon-beta (IFN-β) is a type I interferon, which is a group of signaling proteins made and released by host cells in response to the presence of several viruses, including double-stranded RNA produced by many viruses. IFN-β is a single protein species and is molecularly related to IFN-α subtypes, although it is antigenically distinct from them. It is mainly produced by fibroblasts and plays a crucial role in the innate immune response against viruses. IFN-β can inhibit viral replication by interfering with the virus's RNA or DNA, thus suppressing viral growth. It also enhances the cytotoxic activity of natural killer (NK) cells and promotes the expression of major histocompatibility complex (MHC) class I molecules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0660 Product name: Recombinant Mouse IFN-beta protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 22-182 aa of NM_010510.1 Sequence: INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN Predict reactive species\nFull Name: interferon beta 1, fibroblast\nCalculated Molecular Weight: 22KD\nGenBank Accession Number: NM_010510.1\nGene Symbol: Ifnb1\nGene ID (NCBI): 15977\nRRID: AB_3672229\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P01575\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888571469993,"sku":"98082-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98082-1-rr","provider":"Iright","version":"1.0","type":"link"}