{"product_id":"proteintech-98087-1-rr","title":"Proteintech, 98087-1-RR, Anti-Human IL-6 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-6 (98087-1-RR) by Proteintech is a Recombinant antibody targeting IL-6 in FC (Intra) applications with reactivity to human samples\n98087-1-RR targets IL-6 in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: LPS and Brefeldin A treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0117 Product name: Recombinant Human IL-6 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc \u0026amp; 6*His Domain: 30-212 aa of BC015511 Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Predict reactive species\nFull Name: interleukin 6 (interferon, beta 2)\nCalculated Molecular Weight: 212 aa, 24 kDa\nGenBank Accession Number: BC015511\nGene Symbol: IL6\nGene ID (NCBI): 3569\nENSEMBL Gene ID: ENSG00000136244\nRRID: AB_3672234\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P05231\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888554561705,"sku":"98087-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98087-1-rr","provider":"Iright","version":"1.0","type":"link"}