{"product_id":"proteintech-98211-1-rr","title":"Proteintech, 98211-1-RR, Anti-Human CXCL9\/MIG Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CXCL9\/MIG (98211-1-RR) by Proteintech is a Recombinant antibody targeting CXCL9\/MIG in FC (Intra) applications with reactivity to human samples\n98211-1-RR targets CXCL9\/MIG in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: IFN gamma, TNF α and Brefeldin A treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL9 is a small cytokine known as MIG. CXCL9 is a T-cell chemoattractant, which is induced by IFN-γ. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. A high level of CXCL9 revealed in peripheral liquids, can be considered as a marker of host immune response, especially of that involving Th1 cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17932 Product name: Recombinant human CXCL9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-125 aa of BC095396 Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 9\nCalculated Molecular Weight: 14 kDa\nGenBank Accession Number: BC095396\nGene Symbol: CXCL9\nGene ID (NCBI): 4283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q07325\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888548434089,"sku":"98211-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98211-1-rr","provider":"Iright","version":"1.0","type":"link"}