{"product_id":"proteintech-98247-1-rr","title":"Proteintech, 98247-1-RR, Anti-Human TSLP Rabbit Recombinant Antibody","description":"Size: 100ug\nThe TSLP (98247-1-RR) by Proteintech is a Recombinant antibody targeting TSLP in FC (Intra) applications with reactivity to human samples\n98247-1-RR targets TSLP in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: IL-4, TNF-α and BFA treated HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSLP is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain, it mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Another isoform of this protein may act as an antimicrobial peptide in the oral cavity and on the skin (PMID: 24850429).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1238 Product name: Recombinant Human TSLP protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-159 aa of NM_033035.5 Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species\nFull Name: thymic stromal lymphopoietin\nCalculated Molecular Weight: 18 kDa\nGenBank Accession Number: NM_033035.5\nGene Symbol: TSLP\nGene ID (NCBI): 85480\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q969D9-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888559804585,"sku":"98247-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98247-1-rr","provider":"Iright","version":"1.0","type":"link"}