{"product_id":"proteintech-98263-1-rr","title":"Proteintech, 98263-1-RR, Anti-Human TMIGD2\/CD28H Rabbit Recombinant Antibody","description":"Size: 100ug\nThe TMIGD2\/CD28H (98263-1-RR) by Proteintech is a Recombinant antibody targeting TMIGD2\/CD28H in FC applications with reactivity to human samples\n98263-1-RR targets TMIGD2\/CD28H in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransmembrane and immunoglobulin domain-containing protein 2 (TMIGD2, also known as CD28H and IGPR1), plays a role in cell-cell interaction, migration, and angiogenesis. Through interaction with HHLA2, it costimulates T-cells in the context of TCR-mediated activation and enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade (PMID: 22419821; 23784006). TMIGD2 has been associated with several diseases, particularly in the context of cancer. It is aberrantly expressed by human AML cells and can be used to identify and enrich functional LSCs (PMID: 38167704).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2264 Product name: Recombinant Human TMIGD2\/CD28H protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-150 aa of BC015655 Sequence: LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG Predict reactive species\nFull Name: transmembrane and immunoglobulin domain containing 2\nCalculated Molecular Weight: 282 aa, 31 kDa\nGenBank Accession Number: BC015655\nGene Symbol: TMIGD2\nGene ID (NCBI): 126259\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q96BF3\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888559214761,"sku":"98263-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98263-1-rr","provider":"Iright","version":"1.0","type":"link"}