{"product_id":"proteintech-98265-4-rr","title":"Proteintech, 98265-4-RR, Anti-Human CXCL10\/IP-10 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CXCL10\/IP-10 (98265-4-RR) by Proteintech is a Recombinant antibody targeting CXCL10\/IP-10 in FC (Intra) applications with reactivity to human samples\n98265-4-RR targets CXCL10\/IP-10 in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: IFN gamma and Brefeldin A treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL10 (also known as IP-10) is a member of the CXC chemokine family which binds to the CXCR3 receptor to exert its biological effects. CXCL10 is a 12-kDa protein and constitutes two internal disulfide cross bridges. The predicted signal peptidase cleavage generates a 10-kDa secreted polypeptide with four conserved cysteine residues in the N-terminal. The CXCL10 gene localizes on chromosome 4 at band q21, a locus associated with an acute monocytic\/B-lymphocyte lineage leukemia exhibiting translocation of t (4; 11) (q21; q23). CXCL10 mediates leukocyte trafficking, adaptive immunity, inflammation, haematopoiesis and angiogenesis. Under proinflammatory conditions CXCL10 is secreted from a variety of cells, such as leukocytes, activated neutrophils, eosinophils, monocytes, epithelial cells, endothelial cells, stromal cells (fibroblasts) and keratinocytes in response to IFN-γ.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2489 Product name: Recombinant Human CXCL10\/IP-10 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-98 aa of BC010954 Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 10\nCalculated Molecular Weight: 11 kDa\nGenBank Accession Number: BC010954\nGene Symbol: CXCL10\nGene ID (NCBI): 3627\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02778\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888548237481,"sku":"98265-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98265-4-rr","provider":"Iright","version":"1.0","type":"link"}