{"product_id":"proteintech-98341-1-rr","title":"Proteintech, 98341-1-RR, Anti-Mouse ICOS\/CD278 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe ICOS\/CD278 (98341-1-RR) by Proteintech is a Recombinant antibody targeting ICOS\/CD278 in FC applications with reactivity to mouse samples\n98341-1-RR targets ICOS\/CD278 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Anti-CD3\/CD28 treated BALB\/c spleen cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3198 Product name: Recombinant Mouse ICOS\/CD278 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-144 aa of NM_017480.2 Sequence: EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWL Predict reactive species\nFull Name: inducible T-cell co-stimulator\nCalculated Molecular Weight: 23kDa\nGenBank Accession Number: NM_017480.2\nGene Symbol: Icos\nGene ID (NCBI): 54167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9WVS0\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888571076777,"sku":"98341-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98341-1-rr","provider":"Iright","version":"1.0","type":"link"}