{"product_id":"proteintech-98363-1-rr","title":"Proteintech, 98363-1-RR, Anti-Human IL-3 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-3 (98363-1-RR) by Proteintech is a Recombinant antibody targeting IL-3 in FC (Intra) applications with reactivity to human samples\n98363-1-RR targets IL-3 in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-3 (IL-3) is a multilineage hematopoietic growth factor that promotes the proliferation, differentiation and survival of early multilineage hematopoietic progenitors. In particular, this cytokine plays a key role in stimulating the proliferation and survival of myeloid precursors. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. (PMID: 24103757;2698876;2809196)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0829 Product name: Recombinant Human IL-3 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-152 aa of NM_000588.3 Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF Predict reactive species\nFull Name: interleukin 3 (colony-stimulating factor, multiple)\nCalculated Molecular Weight: 17 kDa\nGenBank Accession Number: NM_000588.3\nGene Symbol: IL-3\nGene ID (NCBI): 3562\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P08700\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888553775273,"sku":"98363-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98363-1-rr","provider":"Iright","version":"1.0","type":"link"}