{"product_id":"proteintech-98364-2-rr","title":"Proteintech, 98364-2-RR, Anti-Human IL-33 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-33 (98364-2-RR) by Proteintech is a Recombinant antibody targeting IL-33 in FC (Intra) applications with reactivity to human samples\n98364-2-RR targets IL-33 in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-33 is an IL-1 family cytokine and nuclear alarmin, is constitutively expressed in epithelial barrier tissues and human blood vessels. IL-33 is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. It also acts as a chemoattractant for Th2 cells, and may function as an \"alarmin\", that amplifies immune responses during tissue injury.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg7061 Product name: Recombinant human IL33 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 122-270 aa of BC047085 Sequence: YLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET Predict reactive species\nFull Name: interleukin 33\nCalculated Molecular Weight: 30 kDa\nGenBank Accession Number: BC047085\nGene Symbol: IL-33\nGene ID (NCBI): 90865\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95760\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888699134121,"sku":"98364-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98364-2-rr","provider":"Iright","version":"1.0","type":"link"}