{"product_id":"proteintech-98395-1-rr","title":"Proteintech, 98395-1-RR, Anti-Mouse CLEC9A\/CD370 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CLEC9A\/CD370 (98395-1-RR) by Proteintech is a Recombinant antibody targeting CLEC9A\/CD370 in FC applications with reactivity to mouse samples\n98395-1-RR targets CLEC9A\/CD370 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLEC9A (C-type lectin domain family 9 member A), also known as DNGR1, CD370, is a type II membrane protein that contains C-type lectin domain. The C-type lectin domain family members share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. Mouse Clec9A is primarily restricted to dendritic cells (DCs) and selectively expressed in mouse CD8+ conventional DCs (cDCs) and plasmacytoid DCs (pDCs), whereas human CLEC9A is also expressed on human DC subtypes. CLEC9A functions as an activating receptor that recruits Syk kinase and can induce the production of proinflammatory cytokines. (PMID: 25553393; PMID: 15476922; PMID: 18669894; PMID: 18408006)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2730 Product name: Recombinant Mouse Clec9a protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 57-264 aa of NM_001205363.1 Sequence: KFFQVSSLVLEQQERLIQQDTALVNLTQWQRKYTLEYCQALLQRSLHSGTDASTGPVLLTSPQMVPQTLDSKETGSDCSPCPHNWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGNKYWVGVFQDGISGSWFWEDGSSPLSDLLPAERQRSAGQICGYLKDSTLISDKCDSWKYFICEKKAFGSCI Predict reactive species\nFull Name: C-type lectin domain family 9, member a\nCalculated Molecular Weight: 30 kDa\nGenBank Accession Number: NM_001205363.1\nGene Symbol: Clec9a\nGene ID (NCBI): 232414\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8BRU4-4\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888702804137,"sku":"98395-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98395-1-rr","provider":"Iright","version":"1.0","type":"link"}