{"product_id":"proteintech-98399-1-rr","title":"Proteintech, 98399-1-RR, Anti-Mouse SDC2 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe SDC2 (98399-1-RR) by Proteintech is a Recombinant antibody targeting SDC2 in FC applications with reactivity to mouse samples\n98399-1-RR targets SDC2 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSDC2, containing cell surface heparan sulphate proteoglycan, functions as an integral membrane protein and participates in cell proliferation, cell migration, cell adhesion and signal transduction. It has been reported that the expression level of SDC2 will be up-regulated under hypoxia condition which can induce increased release of cytokines and chemokines. Besides, methylated SDC2 can be used as a potential biomarker for early diagnosis of colon cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2700 Product name: Recombinant Mouse SDC2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-145 aa of NM_008304.2 Sequence: ETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGADEDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEEKLGPAIKSTDVYTEKHSDNLFKRTE Predict reactive species\nFull Name: syndecan 2\nCalculated Molecular Weight: 22 kDa\nGenBank Accession Number: NM_008304.2\nGene Symbol: SDC2\nGene ID (NCBI): 15529\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P43407\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888581267625,"sku":"98399-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98399-1-rr","provider":"Iright","version":"1.0","type":"link"}