{"product_id":"proteintech-98409-2-rr","title":"Proteintech, 98409-2-RR, Anti-Mouse CD134\/OX40 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD134\/OX40 (98409-2-RR) by Proteintech is a Recombinant antibody targeting CD134\/OX40 in FC applications with reactivity to mouse samples\n98409-2-RR targets CD134\/OX40 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: CD3\/CD28 treated BALB\/c mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD134, also known as OX40 and TNFRSF4, is a member of the TNFR-superfamily of receptors (PMID: 2828930; 9766631). It is a type I transmembrane protein predominantly expressed on activated T cells which include CD4 and CD8 T cells, Th2, Th1, and Th17 cells, as well as regulatory T cells (Tregs) (PMID: 20307208). CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule (PMID: 26215166). CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmune diseases, cancer and infectious disease (PMID: 26215166; 19426222).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2936 Product name: Recombinant Mouse CD134\/OX40 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-211 aa of NM_011659.2 Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 4\nCalculated Molecular Weight: 30 kDa\nGenBank Accession Number: NM_011659.2\nGene Symbol: CD134\nGene ID (NCBI): 22163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P47741\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888564916393,"sku":"98409-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98409-2-rr","provider":"Iright","version":"1.0","type":"link"}