{"product_id":"proteintech-98415-1-rr","title":"Proteintech, 98415-1-RR, Anti-Human CRLF2 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CRLF2 (98415-1-RR) by Proteintech is a Recombinant antibody targeting CRLF2 in FC applications with reactivity to human samples\n98415-1-RR targets CRLF2 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human monocyte-derived mature dendritic cells, CRLF2-transfected CHO cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytokine receptor-like factor 2 (CRLF2), also known as the thymic stromal derived lymphopoietin receptor (TSLPR), which in combination with the interleukin 7 receptor a chain (IL-7R) forms the receptor for thymic stromal lymphopoietin. CRLF2 is a type I cytokine receptor. CRLF2 rearrangements occur either as a translocation to the immunoglobulin heavy-chain enhancer region (IGH-CRLF2) or by a deletion of upstream PAR1 that leads to joining of CRLF2 to adjacent P2RY8. CRLF2 is expressed in heart, skeletal muscle, kidney and adult and fetal liver and is primarily expressed in dendrites and monocytes. (PMID: 20807819; 31644323; 33485429)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2626 Product name: Recombinant Human CRLF2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-231 aa of NM_022148.3 Sequence: GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK Predict reactive species\nFull Name: cytokine receptor-like factor 2\nCalculated Molecular Weight: 42 kDa\nGenBank Accession Number: NM_022148.3\nGene Symbol: CRLF2\nGene ID (NCBI): 64109\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9HC73\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888547975337,"sku":"98415-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98415-1-rr","provider":"Iright","version":"1.0","type":"link"}