{"product_id":"proteintech-98421-4-rr","title":"Proteintech, 98421-4-RR, Anti-Mouse IL-27 p28 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-27 p28 (98421-4-RR) by Proteintech is a Recombinant antibody targeting IL-27 p28 in FC (Intra) applications with reactivity to mouse samples\n98421-4-RR targets IL-27 p28 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: IFN gamma, LPS and Brefeldin A treated RAW264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-27, as a member of the IL-6\/IL-12 family, is a heterodimeric cytokine composed of two subunits: p28 (IL-27a) and EBI3 (IL-27b). IL-27 acts on various cell types, including T cells, B cells, macrophages, dendritic cells, natural killer (NK) cells and non-hematopoietic cells. IL-27 plays a critical role in the early regulation of T helper type 1 initiation, and enhances proliferation of naive CD4+T cells and naive B cells. It, however, also exerts anti-inflammatory functions by inhibiting the development of Th17 cells and inducing IL-10 producing type 1 regulatory T cells. IL-27 is a potentially promising cytokine for therapeutic approaches on various human diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0897 Product name: Recombinant Mouse IL-27A protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-234 aa of Sequence: FPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS Predict reactive species\nFull Name: interleukin 27\nGene Symbol: Il27\nGene ID (NCBI): 246779\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O35228(IL27B)+Q8K3I6(IL27A)\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888703393961,"sku":"98421-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98421-4-rr","provider":"Iright","version":"1.0","type":"link"}