{"product_id":"proteintech-98430-1-rr","title":"Proteintech, 98430-1-RR, Anti-Rat Fas Ligand\/CD178 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe Fas Ligand\/CD178 (98430-1-RR) by Proteintech is a Recombinant antibody targeting Fas Ligand\/CD178 in FC applications with reactivity to rat samples\n98430-1-RR targets Fas Ligand\/CD178 in FC applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD178, also known as Fas ligand, is a type II transmembrane protein that belongs to the tumor necrosis factor (TNF) family. It is expressed on NK cells, cytotoxic T lymphocytes and activated CD4+ Th1 cells. CD178 transduces apoptotic signal into cells by binding to FAS\/CD95. It is involved as a death factor in the regulation of activation-induced cell death, establishment of immune privilege and tumor cell survival.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3218 Product name: Recombinant Rat Fas Ligand\/TNFSF6 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 103-278 aa of NM_012908.1 Sequence: HLQKELAELREFTNHSLRVSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVINEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSSYLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL Predict reactive species\nFull Name: Fas ligand (TNF superfamily, member 6)\nCalculated Molecular Weight: 31 kDa\nGenBank Accession Number: NM_012908.1\nGene Symbol: Faslg\nGene ID (NCBI): 25385\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P36940\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888587296937,"sku":"98430-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98430-1-rr","provider":"Iright","version":"1.0","type":"link"}