{"product_id":"proteintech-98456-3-rr","title":"Proteintech, 98456-3-RR, Anti-Mouse CD47 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD47 (98456-3-RR) by Proteintech is a Recombinant antibody targeting CD47 in FC applications with reactivity to mouse samples\n98456-3-RR targets CD47 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1394 Product name: Recombinant Mouse CD47 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-140 aa of NP_001355344.1 Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK Predict reactive species\nFull Name: CD47 antigen (Rh-related antigen, integrin-associated signal transducer)\nCalculated Molecular Weight: 33 kDa\nGenBank Accession Number: NP_001355344.1\nGene Symbol: Cd47\nGene ID (NCBI): 16423\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q61735-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888567275689,"sku":"98456-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98456-3-rr","provider":"Iright","version":"1.0","type":"link"}