{"product_id":"proteintech-98477-1-rr","title":"Proteintech, 98477-1-RR, Anti-Human LILRA5\/CD85f Rabbit Recombinant Antibody","description":"Size: 100ug\nThe LILRA5\/CD85f (98477-1-RR) by Proteintech is a Recombinant antibody targeting LILRA5\/CD85f in FC applications with reactivity to human samples\n98477-1-RR targets LILRA5\/CD85f in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLILRA5, also named as CD85f, ILT11, LILRB7 or LIR9, is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is a group of immune inhibitory and stimulatory receptors (PMID: 15304001). There are two membrane-bound and two soluble forms of LILRA5. The transmembrane LILRA5 contains a short cytoplasmic domain and a charged arginine residue within the transmembrane region (PMID: 19009525). It is mostly expressed in myeloid cells, including monocytes and neutrophils (PMID: 12393390). LILRA5 may play a role in triggering innate immune responses. It does not function in class I MHC antigens recognition (PMID: 16675463).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2737 Product name: Recombinant Human LILRA5\/CD85f protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 42-268 aa of NM_021250.4 Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR Predict reactive species\nFull Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5\nCalculated Molecular Weight: 33 kDa\nGenBank Accession Number: NM_021250.4\nGene Symbol: LILRA5\nGene ID (NCBI): 353514\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: A6NI73-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888556069033,"sku":"98477-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98477-1-rr","provider":"Iright","version":"1.0","type":"link"}