{"product_id":"proteintech-98497-3-rr","title":"Proteintech, 98497-3-RR, Anti-Rat CXCL7\/PPBP Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CXCL7\/PPBP (98497-3-RR) by Proteintech is a Recombinant antibody targeting CXCL7\/PPBP in FC (Intra) applications with reactivity to rat samples\n98497-3-RR targets CXCL7\/PPBP in FC (Intra) applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPBP, slso named as NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3405 Product name: recombinant rat CXCL7\/Thymus Chemokine-1 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 46-107 aa of NM_153721.1 Sequence: IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI Predict reactive species\nFull Name: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)\nCalculated Molecular Weight: 12 kDa\nGenBank Accession Number: NM_153721.1\nGene Symbol: Ppbp\nGene ID (NCBI): 246358\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99ME0\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888587067561,"sku":"98497-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98497-3-rr","provider":"Iright","version":"1.0","type":"link"}