{"product_id":"proteintech-98505-5-rr","title":"Proteintech, 98505-5-RR, Anti-Mouse S100A9 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe S100A9 (98505-5-RR) by Proteintech is a Recombinant antibody targeting S100A9 in FC (Intra) applications with reactivity to mouse samples\n98505-5-RR targets S100A9 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: C57BL\/6 bone marrow cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8\/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8\/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2600 Product name: Recombinant Mouse S100a9 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 2-113 aa of NM_001281852.1 Sequence: ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK Predict reactive species\nFull Name: S100 calcium binding protein A9 (calgranulin B)\nCalculated Molecular Weight: 13 kDa\nGenBank Accession Number: NM_001281852.1\nGene Symbol: S100a9\nGene ID (NCBI): 20202\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P31725\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888704606377,"sku":"98505-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98505-5-rr","provider":"Iright","version":"1.0","type":"link"}