{"product_id":"proteintech-98553-1-rr","title":"Proteintech, 98553-1-RR, Anti-Mouse CCL17\/TARC Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CCL17\/TARC (98553-1-RR) by Proteintech is a Recombinant antibody targeting CCL17\/TARC in FC (Intra) applications with reactivity to mouse samples\n98553-1-RR targets CCL17\/TARC in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL17, also named as TARC, is a member of the CC chemokine family, and is highly expressed by thymus and other cells, including keratinocytes, endothelial cells, dendritic cells, bronchial epithelial cells and fibroblasts. CCL17 plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3319 Product name: recombinant mouse Ccl17 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-93 aa of NM_011332.3 Sequence: ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP Predict reactive species\nFull Name: chemokine (C-C motif) ligand 17\nCalculated Molecular Weight: 11 kDa\nGenBank Accession Number: NM_011332.3\nGene Symbol: Ccl17\nGene ID (NCBI): 20295\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: F6R5P4\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888560623785,"sku":"98553-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98553-1-rr","provider":"Iright","version":"1.0","type":"link"}