{"product_id":"proteintech-98613-3-rr","title":"Proteintech, 98613-3-RR, Anti-Pig IL-4 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-4 (98613-3-RR) by Proteintech is a Recombinant antibody targeting IL-4 in FC (Intra) applications with reactivity to pig samples\n98613-3-RR targets IL-4 in FC (Intra) applications and shows reactivity with pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected CHO cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL-4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL-4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4866 Product name: Recombinant Pig IL-4 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 25-133 aa of NM_214123.1 Sequence: HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC Predict reactive species\nFull Name: Interleukin-4\nCalculated Molecular Weight: 15 kDa\nGenBank Accession Number: NM_214123.1\nGene Symbol: IL-4\nGene ID (NCBI): 397225\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q04745\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888584315049,"sku":"98613-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98613-3-rr","provider":"Iright","version":"1.0","type":"link"}