{"product_id":"proteintech-98627-1-rr","title":"Proteintech, 98627-1-RR, Anti-Mouse LIGHT\/CD258 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe LIGHT\/CD258 (98627-1-RR) by Proteintech is a Recombinant antibody targeting LIGHT\/CD258 in FC applications with reactivity to mouse samples\n98627-1-RR targets LIGHT\/CD258 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: anti-CD3\/CD28 treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIGHT, also known as TNFSF14, HVEML, or CD258, is a type II transmembrane protein that belongs to the TNF superfamily (PMID: 9462508). It is predominantly expressed in lymphoid tissues and produced by activated T cells and immature dendritic cells (DCs) (PMID: 9462508; 10754304). Through its two primary functional receptors HVEM (TNFRSF14) and lymphotoxin β receptor (LTβR), LIGHT signaling is involved in development and maintenance of lymphoid tissues, as well as innate and adaptive immune responses (PMID: 24575096; 26720335). In addition to the membrane form, LIGHT can also exist as a soluble form generated by cleavage of the extracellular portion of the membrane form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2654 Product name: Recombinant Mouse LIGHT\/CD258 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 72-239 aa of NM_019418.3 Sequence: DGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 14\nCalculated Molecular Weight: 26 kDa\nGenBank Accession Number: NM_019418.3\nGene Symbol: Tnfsf14\nGene ID (NCBI): 50930\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9QYH9\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888578187433,"sku":"98627-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98627-1-rr","provider":"Iright","version":"1.0","type":"link"}