{"product_id":"proteintech-98689-3-rr","title":"Proteintech, 98689-3-RR, Anti-Canine CXCL8\/IL-8 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CXCL8\/IL-8 (98689-3-RR) by Proteintech is a Recombinant antibody targeting CXCL8\/IL-8 in FC (Intra) applications with reactivity to canine samples\n98689-3-RR targets CXCL8\/IL-8 in FC (Intra) applications and shows reactivity with canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected CHO\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin 8 (IL-8), also known as CXCL8, is a CXC chemokine family member. This chemokine is secreted by a variety of cell types including monocyte\/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4552 Product name: Recombinant Canine CXCL8\/IL-8 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-101 aa of NM_001003200.1 Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP Predict reactive species\nFull Name: Interleukin-8\nCalculated Molecular Weight: 11 kDa\nGenBank Accession Number: NM_001003200.1\nGene Symbol: IL-8\nGene ID (NCBI): 403850\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P41324\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888693432489,"sku":"98689-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98689-3-rr","provider":"Iright","version":"1.0","type":"link"}