{"product_id":"proteintech-98714-2-rr","title":"Proteintech, 98714-2-RR, Anti-Pig CD19 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD19 (98714-2-RR) by Proteintech is a Recombinant antibody targeting CD19 in FC applications with reactivity to pig samples\n98714-2-RR targets CD19 in FC applications and shows reactivity with pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: pig PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD19 is a type I transmembrane glycoprotein belonging to the immunoglobulin superfamily (PMID: 2472450). It is expressed by B cells and follicular dendritic cells. CD19 is up-regulated at the step of B-lineage commitment during the differentiation of the hematopoietic stem cell, it remains on during subsequent stages of differentiation until finally down-regulated during terminal differentiation into plasma cells (PMID: 8528044). CD19 is involved in B cell development, activation and differentiation. It is the dominant component for the signaling complex on B cells that includes CD21 (CR2), CD81 (TAPA-1) and CD225 and acts as a critical co-receptor for BCR signal transduction (PMID: 23210908).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg7132 Product name: Recombinant pig CD19 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-304 aa of XM_013995590.1 Sequence: RPQEPYLVEAQEGGNAVLPCLEGPSEGPPEQLAWFRGSQSTPFLELSLGLPGLGIHVGPLGTLKEPQGTLLFIFNVSDQMGGFYLCQQGPPLDQSWQPGWTVNVKGSGELFRWNASDLNDPSCDLGARSSEGRRSSSSHPTRSKLYVWAKNQAKVLHTDLTCPPPNSTVNQSNSHDLTVAPGSTLSLSCGSSRASLVRGPISWIHVRPKKHVKLLSLNLTEDAQLREMWVMGSLRGKAVLLLPEATAQDADTYHCNHGNVTTQMRLKVTARSVWHWLLETGG Predict reactive species\nFull Name: CD19 molecule\nCalculated Molecular Weight: 63 kDa\nGenBank Accession Number: XM_013995590.1\nGene Symbol: CD19\nGene ID (NCBI): 397669\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: A0A8D0M7A3\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888705392809,"sku":"98714-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-98714-2-rr","provider":"Iright","version":"1.0","type":"link"}