{"product_id":"proteintech-apc-fca98070","title":"Proteintech, APC-FcA98070, FcZero-rAb™ APC Anti-Human Granzyme B Rabbit Recombinant Antibody","description":"Size: 100tests\nThe Granzyme B (APC-FcA98070) by Proteintech is a Recombinant antibody targeting Granzyme B in FC (Intra) applications with reactivity to human samples\nAPC-FcA98070 targets Granzyme B in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGZMB (Granzyme B) is also named as CGL1, CSPB, CTLA1, GRB and belongs to the Granzyme subfamily. This enzyme is necessary for target cell lysis in cell-mediated immune responses. The cytotoxic lymphocyte protease granzyme B can promote apoptosis through direct processing and activation of members of the caspase family. Granzyme B can also cleave the BH3-only protein, BID, to promote caspase-independent mitochondrial permeabilization (PMID:17283187). Granzyme B induces lamin B degradation in isolated nuclei less efficiently than Granzyme A (PMID:11331782).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0592 Product name: Recombinant Human Granzyme B protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*HIS Domain: 19-247 aa of BC030195 Sequence: GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY Predict reactive species\nFull Name: granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)\nCalculated Molecular Weight: 247 aa, 28 kDa\nGenBank Accession Number: BC030195\nGene Symbol: Granzyme B\nGene ID (NCBI): 3002\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10144\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888748810409,"sku":"APC-FcA98070","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-apc-fca98070","provider":"Iright","version":"1.0","type":"link"}