{"product_id":"proteintech-apc-fca98120","title":"Proteintech, APC-FcA98120, FcZero-rAb™ APC Anti-Mouse CD40L\/CD154 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD40L\/CD154 (APC-FcA98120) by Proteintech is a Recombinant antibody targeting CD40L\/CD154 in FC applications with reactivity to mouse samples\nAPC-FcA98120 targets CD40L\/CD154 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: PMA and ionomycin treated mouse CD3+ T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe CD40 ligand (CD40L, TRAP, CD154), a member of the TNF superfamily of ligands, is expressed as either a 33-kd transmembrane homologue or 18-kd soluble form (sCD154). CD40L is primarily expressed on activated CD4+ T cells and on a small proportion of CD8+ T cells and platelets. It binds to CD40 on antigen-presenting cells (APC), which leads to many effects depending on the target cell type. It has been suggested that CD40\/CD40L interactions regulate oxidative stress and affect various signaling pathways in both the immunological and the cardiovascular systems. The CD40\/CD40L system is also involved in tumorigenesis. Its expression is tightly regulated, and abnormal levels of CD40L are associated with the pathogenesis of atheromatous plaque destabilization and thrombotic events. Multiple mutations in CD40LG gene have been identified that are associated with hyper-IgM immunodeficiency syndrome type 1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0990 Product name: Recombinant Mouse CD40 Ligand\/TNFSF5 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-His Domain: 115-260 aa of NM_011616.2 Sequence: GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL Predict reactive species\nFull Name: CD40 ligand\nCalculated Molecular Weight: 29 kDa\nGenBank Accession Number: NM_011616.2\nGene Symbol: CD154\nGene ID (NCBI): 21947\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P27548\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888629108905,"sku":"APC-FcA98120","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-apc-fca98120","provider":"Iright","version":"1.0","type":"link"}