{"product_id":"proteintech-apc-fca98169","title":"Proteintech, APC-FcA98169, FcZero-rAb™ APC Anti-Human CEACAM3\/6 (CD66c\/d) Rabbit Recombinant Antibody","description":"Size: 100tests\nThe CEACAM3\/6 (CD66c\/d) (APC-FcA98169) by Proteintech is a Recombinant antibody targeting CEACAM3\/6 (CD66c\/d) in FC applications with reactivity to human samples\nAPC-FcA98169 targets CEACAM3\/6 (CD66c\/d) in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human peripheral blood leukocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCarcinoembryonic antigen-related cell adhesion molecules (CEACAMs) belong to the immunoglobulin superfamily of cell adhesion molecules. CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in controlling cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). CEACAM3, also named as CD66d and CGM1, is exclusively expressed on granulocytes and acts as the major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms (PMID: 18606569). CEACAM6, also known as CD66c, is normally expressed on the surface of myeloid and epithelial surfaces and upregulated preferentially at the apical\/luminal membranes of many tumors (PMID: 27595061; 35082925). This antibody is raised against 35-155 aa of human CEACAM3\/CD66d and can cross-react with CEACAM6\/CD66c.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0144 Product name: Recombinant Human CEACAM-3 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc \u0026amp; 6*His Domain: 35-155 aa of BC106728 Sequence: KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG Predict reactive species\nFull Name: carcinoembryonic antigen-related cell adhesion molecule 3\nCalculated Molecular Weight: 252 aa, 27 kDa\nGenBank Accession Number: BC106728\nGene Symbol: CEACAM3\nGene ID (NCBI): 1084\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P40198\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888623505577,"sku":"APC-FcA98169","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-apc-fca98169","provider":"Iright","version":"1.0","type":"link"}