{"product_id":"proteintech-apc-fca98235","title":"Proteintech, APC-FcA98235, FcZero-rAb™ APC Anti-Human CD300e Rabbit Recombinant Antibody","description":"Size: 100tests\nThe CD300e (APC-FcA98235) by Proteintech is a Recombinant antibody targeting CD300e in FC applications with reactivity to human samples\nAPC-FcA98235 targets CD300e in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD300e, also known as immune receptor expressed on myeloid cells 2 (IREM-2), CLM-2, or CMRF35-A5, is one of the CD300 family members which belong to the immunoglobulin (Ig) superfamily (PMID: 15557162; 20039296). CD300e is a type I transmembrane glycoprotein that contains an extracellular region comprising an Ig-like domain, a transmembrane region, and a short cytoplasmic tail (PMID: 15557162; 29358324). It is by monocytes and myeloid dendritic cells and transmits an immune-activating signal by interacting with DNAX-activating protein 12 (DAP12) (PMID: 29358324).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2638 Product name: recombinant human CD300E protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-131 aa of NM_181449.2 Sequence: KGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAI Predict reactive species\nFull Name: CD300e molecule\nCalculated Molecular Weight: 23 kDa\nGenBank Accession Number: NM_181449.2\nGene Symbol: CD300E\nGene ID (NCBI): 342510\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q496F6\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888617640105,"sku":"APC-FcA98235","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-apc-fca98235","provider":"Iright","version":"1.0","type":"link"}