{"product_id":"proteintech-apc-fca98246-2","title":"Proteintech, APC-FcA98246-2, FcZero-rAb™ APC Anti-Mouse BTLA\/CD272 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe BTLA\/CD272 (APC-FcA98246-2) by Proteintech is a Recombinant antibody targeting BTLA\/CD272 in FC applications with reactivity to mouse samples\nAPC-FcA98246-2 targets BTLA\/CD272 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBTLA, also known as CD272, is a member of the CD28 superfamily and is a type I membrane glycoprotein identified as an inhibitory receptor (PMID: 33859648). BTLA is extensively expressed in lymph nodes, thymus, and spleen, with little or no expression in organs such as the heart, kidney, brain, and liver (PMID: 33859648). Among immune cells, BTLA is primarily expressed in B and T cells, with higher expression in B cells compared to T cells in the mouse spleen (PMID: 33859648). BTLA plays a crucial role in regulating stimulatory and inhibitory signals in immune responses.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1843 Product name: Recombinant Mouse BTLA protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-176 aa of AAI08964.1 Sequence: EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG Predict reactive species\nFull Name: B and T lymphocyte associated\nCalculated Molecular Weight: 34kDa\nGenBank Accession Number: AAI08964.1\nGene Symbol: Btla\nGene ID (NCBI): 208154\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nExcitation Laser: Red Laser (633 nm)\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q32MV9\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888750252201,"sku":"APC-FcA98246-2","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-apc-fca98246-2","provider":"Iright","version":"1.0","type":"link"}