{"product_id":"proteintech-apc-fca98283","title":"Proteintech, APC-FcA98283, FcZero-rAb™ APC Anti-Human Nectin-2\/CD112 Rabbit Recombinant Antibody","description":"Size: 100tests\nThe Nectin-2\/CD112 (APC-FcA98283) by Proteintech is a Recombinant antibody targeting Nectin-2\/CD112 in FC applications with reactivity to human samples\nAPC-FcA98283 targets Nectin-2\/CD112 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNectin 2, also named as PVRL2, CD112, HVEB, PRR2 and PVRR2, is an adhesion molecule widely expressed in cell lines of different lineages, including hematopoietic, neuronal, endothelial and epithelial cells. CD112 belongs to a new family of immunoglobulin-like molecules that includes four members (CD111, CD112, PRR3 and CD155) sharing an ectodomain made of three Ig domains, of V and C types. CD112 is expressed in the myelo-monocytic and megakaryocytic hematopoietic lineages and the function in hematopoiesis is currently unknown. CD112 is an intercellular homophilic adhesion. CD112 localizes specifically at adherents junctions via its cytoplasmic interaction with the scaffold F-actin binding protein afadin. Disruption of the murine CD112 gene leads to infertility of male mice with morphologically aberrant spermatozoa. CD112 mediates entry of some alphaherpesvirus mutants (also named HveB) via its V domain. CD112 is involved in cell to cell spreading of viruses.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1670 Product name: Recombinant Human Nectin-2\/CD112 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-360 aa of NM_001042724.2 Sequence: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL Predict reactive species\nFull Name: poliovirus receptor-related 2 (herpesvirus entry mediator B)\nCalculated Molecular Weight: 58 kDa\nGenBank Accession Number: NM_001042724.2\nGene Symbol: Nectin-2\/CD112\nGene ID (NCBI): 5819\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92692-2\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888626094249,"sku":"APC-FcA98283","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-apc-fca98283","provider":"Iright","version":"1.0","type":"link"}