{"product_id":"proteintech-biotin-fca98039","title":"Proteintech, Biotin-FcA98039, FcZero-rAb™ Biotin Anti-Mouse CD200 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD200 (Biotin-FcA98039) by Proteintech is a Recombinant antibody targeting CD200 in FC, ELISA applications with reactivity to mouse samples\nBiotin-FcA98039 targets CD200 in FC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD200, also known as OX2, is a type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 3032785). It contains two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. CD200 is expressed on a variety of cell types, including thymocytes, B lymphocytes, a subset of T lymphocytes, follicular dendritic cells, neurons, and endothelial cells (PMID: 3032785; 10981966). CD200 binds to its receptor, CD200R, which is primarily expressed by myeloid and T cell lineage (PMID: 15187158). The CD200-CD200R interaction plays a role in immunosuppression and suppression of anti-tumor immune responses (PMID: 22020332).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0920 Product name: Recombinant mouse CD200 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 31-232 aa of \/ Sequence: QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG Predict reactive species\nFull Name: CD200 antigen\nCalculated Molecular Weight: 31 kDa\nGenBank Accession Number: \/\nGene Symbol: Cd200\nGene ID (NCBI): 17470\nConjugate: Biotin\nExcitation\/Emission Maxima Wavelengths: -\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O54901\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888628027561,"sku":"Biotin-FcA98039","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-biotin-fca98039","provider":"Iright","version":"1.0","type":"link"}