{"product_id":"proteintech-biotin-fca98206","title":"Proteintech, Biotin-FcA98206, FcZero-rAb™ Biotin Anti-Human IL-7 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-7 (Biotin-FcA98206) by Proteintech is a Recombinant antibody targeting IL-7 in FC (Intra), ELISA applications with reactivity to human samples\nBiotin-FcA98206 targets IL-7 in FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-7 (IL-7) is a cytokine involved in B and T cell development. It plays an active role in the development, survival, maintaining and restoring homeostasis of mature T lymphocytes and is a key regulator of the commitment, survival, proliferation and maturation of B cells during development. Furthermore, IL-7 can improve the antiviral function and expansion of natural killer (NK) cells and regulate the development and differentiation of dendritic cells. IL-7 has also been reported as a regulator of the development of central nervous system and myogenesis and skeletal muscle cell migration. (PMID: 29663382; 29655570; 29449560)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0830 Product name: Recombinant Human IL-7 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-177 aa of NM_000880.4 Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH Predict reactive species\nFull Name: interleukin 7\nCalculated Molecular Weight: 20 kDa\nGenBank Accession Number: NM_000880.4\nGene Symbol: IL-7\nGene ID (NCBI): 3574\nConjugate: Biotin\nExcitation\/Emission Maxima Wavelengths: -\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P13232-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888624881833,"sku":"Biotin-FcA98206","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-biotin-fca98206","provider":"Iright","version":"1.0","type":"link"}