{"product_id":"proteintech-biotin-fca98221","title":"Proteintech, Biotin-FcA98221, FcZero-rAb™ Biotin Anti-Human CCL20\/MIP-3 alpha Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CCL20\/MIP-3 alpha (Biotin-FcA98221) by Proteintech is a Recombinant antibody targeting CCL20\/MIP-3 alpha in FC (Intra), ELISA applications with reactivity to human samples\nBiotin-FcA98221 targets CCL20\/MIP-3 alpha in FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: PMA, LPS and Brefeldin A treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL20, also known as macrophage inﬁltrating factor protein 3α, is a C-C chemokine that speciﬁcally binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2398 Product name: Recombinant Human CCL20\/MIP-3 alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 27-96 aa of NM_004591.3 Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Predict reactive species\nFull Name: chemokine (C-C motif) ligand 20\nCalculated Molecular Weight: 11kDa\nGenBank Accession Number: NM_004591.3\nGene Symbol: CCL20\/MIP-3 alpha\nGene ID (NCBI): 6364\nConjugate: Biotin\nExcitation\/Emission Maxima Wavelengths: -\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P78556-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888614592681,"sku":"Biotin-FcA98221","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-biotin-fca98221","provider":"Iright","version":"1.0","type":"link"}