{"product_id":"proteintech-biotin-sf98318","title":"Proteintech, Biotin-SF98318, Biotin Anti-Human CD63 Rabbit scFv Antibody","description":"Size: 100ug\nThe CD63 (Biotin-SF98318) by Proteintech is a Recombinant antibody targeting CD63 in FC applications with reactivity to human samples\nBiotin-SF98318 targets CD63 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Thrombin treated human peripheral blood platelets\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediates signal transduction events that regulate cell development, activation, growth, and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein translocated to the plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it is a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Type: Rabbit \/ IgG\nClass: Recombinant\nType: Single-chain variable fragment antibody (scFv)\nImmunogen: CatNo: Eg2064 Product name: Recombinant Human CD63 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 103-203 aa of BC002349 Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV Predict reactive species\nFull Name: CD63 molecule\nCalculated Molecular Weight: 26 kDa\nGenBank Accession Number: BC002349\nGene Symbol: CD63\nGene ID (NCBI): 967\nConjugate: Biotin\nExcitation\/Emission Maxima Wavelengths: -\nSource: Anti-Human CD63 scFv from clone 241964E1, consisting of VH-GGGGS linker-VL (N- to C-terminus), with His tag at the C-terminus.\nForm: Liquid\nPurification Method: Affinity purification\nStorage Buffer: PBS with 4% sucrose and 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888696185001,"sku":"Biotin-SF98318","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-biotin-sf98318","provider":"Iright","version":"1.0","type":"link"}