Proteintech, CL488-84969-2, CoraLite® Plus 488-conjugated RAD50 Recombinant monoclonal antibody

Size: 100ul The RAD50 (CL488-84969-2) by Proteintech is a Recombinant antibody targeting RAD50 in IF/ICC applications with reactivity to human, mouse, rat samples CL488-84969-2 targets RAD50 in IF/ICC applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RAD50 belongs to the ABC-ATPase protein family that concurs in forming the Nucleotide Binding Domain (NBD). ATP binding to Rad50 induces a conformational change that dramatically increases the Rad50 NBD affinity for itself, allowing for its dimerization (PMID: 37569756). The Mre11-Rad50 (MR) complex has key functions in the detection, signaling and repair of DNA breaks (PMID: 35501303). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29949 Product name: Recombinant human RAD50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 275-425 aa of NM_005732 Sequence: LDSRKKQMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAEKETLK Predict reactive species Full Name: RAD50 homolog (S. cerevisiae) Calculated Molecular Weight: 154 kDa GenBank Accession Number: NM_005732 Gene Symbol: RAD50 Gene ID (NCBI): 10111 Conjugate: CoraLite® Plus 488 Fluorescent Dye Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92878 Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage.