{"product_id":"proteintech-cl488-fca98162","title":"Proteintech, CL488-FcA98162, FcZero-rAb™ CoraLite® Plus 488 Anti-Rat CD90 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD90 (CL488-FcA98162) by Proteintech is a Recombinant antibody targeting CD90 in FC applications with reactivity to rat samples\nCL488-FcA98162 targets CD90 in FC applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: rat thymocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1463 Product name: Recombinant Rat CD90\/Thy1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species\nFull Name: Thy-1 cell surface antigen\nCalculated Molecular Weight: 18 kDa\nGenBank Accession Number: NM_012673.2\nGene Symbol: Thy1\nGene ID (NCBI): 24832\nConjugate: CoraLite® Plus 488 Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 493 nm \/ 522 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01830\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888635924649,"sku":"CL488-FcA98162","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-cl488-fca98162","provider":"Iright","version":"1.0","type":"link"}