{"product_id":"neb-p6043s","title":"New England Biolabs, P6043S, Rapid PNGase F Antibody Standard","description":"Rapid PNGase F Antibody Standard is a murine anti-MBP monoclonal antibody, isotype IgG2a. This antibody standard can be used as a positive control for Rapid PNGase F.  \u003cb\u003eRelated Categories\u003c\/b\u003e Glycoprotein Substrates  \u003cb\u003eApplications\u003c\/b\u003e Glycan Sequencing,, Recombinant Glycoprotein Expression,, Glycoprotein Analysis  \u003cb\u003eSpecification\u003c\/b\u003e \u003cb\u003eIsotype\u003c\/b\u003e Mouse Isotype IgG2a  \u003cb\u003eSource Species\u003c\/b\u003e murine  \u003cb\u003eFAQ\u003c\/b\u003e Q: Is the Rapid PNGase F Antibody Standard a monoclonal antibody? What cell type is used for production? A: Yes, the Rapid PNGase F Antibody Standard is a monoclonal antibody. It is a murine anti-maltose binding protein antibody, isotype IgG2a. Q: What isotype of IgG is the Rapid PNGase F Antibody Standard? A: IgG2a Q: Is the Rapid PNGase F Antibody Standard glycosylated? If so, in what region? A: Yes, the Rapid PNGase F Antibody Standard contains typical IgG glycosylation in a conserved Asn (#295) of the Fc region. There are no other glycosylation sites. Q: Is the Rapid PNGase F Antibody Standard tagged? A: No, Rapid PNGase F Antibody Standard is not tagged. Q: What is the amino acid sequence of the Rapid PNGase F Antibody Standard? Where is the glycosylation site? A: The Rapid PNGase F Antibody Standard has 2 light chains (LC) and 2 heavy chains (HC).The glycosylation site is on the heavy chain at amino acid 295 (indicated in red in the sequence). Light Chain Sequence: MDIVMTQSPSSLAMSVGQKVTMSCKSSQSLLINNNQKNYLAWYQQKPGQSPKLLVYFAST RESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCQQHFTAPYTFGGGTKLEIKRADAAP TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTY SMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC Heavy Chain Sequence: MQVQLQQPGSELVRPGASVKLSCKASGYTFTNSWMHWVKQRPGQGLEWIGNIFPGNGNTN YDENFKSKATLTVDTSSNTAYMQLSSLTSEDSAVYYCTRGLFAYWGQGTLVTVSAAKTTA PSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLS SSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRVPTIKPCPPCKCPAPNLLGGPSVFI FPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRV VSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQ VTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNS YSCSVVHEGLHNHHTTKSFSRTPGK Q: What are the typical N-glycans found on the Rapid PNGase F Antibody Standard? A: The Rapid PNGase F Antibody Standard contains typical IgG glycosylation with mostly GF0, G1F, G2F, as well as some sialylated (mostly NGNA) species. There are also traces of non-fucosylated glycans, high mannose glycans, and hybrid glycans. There is evidence of a1,3-Gal structures. ","brand":"New England Biolabs","offers":[{"title":"Default Title","offer_id":46835525976233,"sku":"P6043S","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/neb-p6043s","provider":"Iright","version":"1.0","type":"link"}